This is a working overview of Quality control, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-03-14. Anything still debated is marked as such rather than presented as settled.
Routine HPLC testing depends on controlled reagents, calibrated instruments, and documented procedures. Columns degrade over time, so retention times and peak shapes are monitored for drift. Mobile phases are filtered and degassed to prevent pump damage and detector noise. Reference standards must be traceable and stored under suitable conditions. Data handling systems record injections, calculations, and audit trails. Quality control samples interspersed with unknowns help detect errors during a run.
Developing an HPLC method begins with defining the purpose, such as quantifying a main component, measuring impurities, or confirming identity. Analysts select separation mode, column, mobile phase, detection, and sample preparation based on analyte properties and matrix. Experiments vary solvent strength, pH, buffer type, and temperature to achieve resolution between critical peaks. The goal is a robust method that produces reliable results across instruments and operators. Method development often involves trial runs and statistical optimization.
Validation demonstrates that a method is suitable for its intended use. Typical performance characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulators and standards organizations provide frameworks, but specific requirements depend on the application and jurisdiction. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, retention time repeatability, and sensitivity. A validated method is not permanently fixed; changes may require partial or full revalidation.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
HPLC testing is an analytical technique used to separate, identify, and quantify components in a liquid sample. It relies on a pressurized mobile phase that carries the sample through a column packed with stationary phase. Different compounds travel at different rates because of interactions with the stationary and mobile phases. The resulting signal versus time is a chromatogram. Peak position indicates identity under specified conditions, while peak area or height relates to amount.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Closeness of measured value to accepted reference value |
| Validation parameter | Precision | Agreement among repeated measurements under specified conditions |
| System suitability check | Resolution ≥ 1.5 | Baseline separation between critical peak pair |
| System suitability check | Tailing factor ≤ 2.0 | Common target for peak symmetry |
| Documentation | Validation report | Summarizes experiments, acceptance criteria, and conclusions |
Routine quality control includes blanks, duplicates, spiked samples, and certified reference materials. Calibration curves are prepared with standards at several concentrations, and the detector response is checked for linearity. Carryover, column aging, mobile phase evaporation, and temperature drift can shift retention times or peak areas. Maintenance such as replacing seals, filters, and columns helps prevent failures. Records of injections, integration, and deviations support traceability. Audits may request raw data and instrument logs for each batch.
Developing an HPLC test begins with defining the analytes, matrix, and required reporting limits. Chemists select a separation mode, column chemistry, mobile phase composition, flow rate, and detection wavelength or mass transition. Experiments then adjust these variables to achieve adequate retention, resolution, and peak shape. System suitability tests confirm that the instrument and method perform consistently before sample analysis. Without suitable resolution, quantitative results may be unreliable. Preliminary runs often use scouting gradients to locate retention windows.
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample by passing them through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in how analytes partition between the mobile phase and the stationary phase cause them to exit the column at different times. Detection then records a signal proportional to the amount of each separated substance. The resulting chromatogram provides retention times and peak areas for identification and quantification.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Typical checks include retention time, peak area precision, resolution between critical pairs, tailing factor, and theoretical plate count. Acceptance criteria are set in the method or pharmacopeial monograph. If a suitability check fails, the run may be rejected and the instrument or sample preparation may need investigation. This practice helps prevent release of data from a system that has drifted out of control.
Several separation modes exist, including reversed-phase, normal-phase, ion-exchange, size-exclusion, and hydrophilic interaction liquid chromatography. Reversed-phase uses a nonpolar stationary phase with a polar mobile phase and is widely applied to small organic molecules. Gradient elution changes mobile phase composition during the run, while isocratic elution keeps it constant. Column chemistry, particle size, temperature, flow rate, and mobile phase pH all influence retention and resolution. Method development selects conditions that separate analytes from matrix components and from each other.
Detection commonly uses ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. Ultraviolet detection depends on molecular chromophores that absorb light at specific wavelengths. Mass spectrometry provides mass information and sensitive quantification, often after electrospray ionization. Before sample batches, performance checks examine resolution, elution time repeatability, peak symmetry, and plate count. Matrix effects and co-elution remain recognized uncertainties; formal validation studies and orthogonal detection help address them. Detector choice depends on analyte properties and required sensitivity.
High-performance liquid chromatography, or HPLC, separates dissolved compounds by passing a liquid mobile phase through a packed column. Components distribute differently between the stationary phase and the moving liquid, so they travel at different speeds and exit at different times. A detector records these eluting bands as peaks, and peak area or height relates to amount. The technique supports testing in pharmaceuticals, foods, environmental samples, and industrial chemicals. Quantification usually depends on calibration with known standards.
Second, Downstream-peptides are consistently positioned in a place that is consistent with a cis-regulatory role in regulating the downstream ORFs, although the biological role of the ORFs is unknown. Third, the pseudoknot structure has a moderate complexity that is typical of riboswitches. Finally, the observation of regulation of a downstream ORF by nitrogen availability also suggests a cis-regulatory role of the element. This hypothesis is supported by biochemical and genetic data. First, both Downstream-peptide RNAs and glnA RNAs selectively bind glutamine. Second, reporter gene analysis of the Downstream-peptide motif revealed that this RNA promotes reporter gene expression upon binding of glutamine and can therefore be considered an activating riboswitch. Possible candidates to be regulated by the Downstream-peptide motif are genes that frequently carry the Downstream-peptide motif in their 5′UTR and encode small, unknown proteins that contain DUF4278 and are putative regulators of glutamine synthetase. This hypothesis is supported by the finding that expression of the DUF4278-containing glutamine synthetase inhibitory factor IF17 encoding gene gifB was shown to be regulated by the structurally related glnA RNA motif. Downstream-peptide RNAs overlap a predicted non-coding RNA called yfr6 that is over 200 nucleotides in length, but it was proposed that only the upstream region (corresponding to the Downstream-peptide motif) functions as an RNA structure. A distinct predicted non-coding RNA called yfr14 overlaps both yfr6 and Downstream-peptide RNAs.
The region has been inhabited by humans since approximately 400,000 years ago. Neanderthals roamed the southwestern Iberian Peninsula until 37,000 years ago, and anatomically modern humans arrived in what is now Portugal around 40,000 years ago. The onset of the Neolithic in the area dates to between 5500 BC and 5300 BC. In southern Portugal, Iron Age inscribed stele have been found, representing early evidence of writing in the Iberian Peninsula. Pre-Celtic tribes originally from the Ukrainian steppes inhabited mainland Portugal and the Lusitanians occupied mostly central, inland regions in 1250 BC. Celts may have spread westwards in Iberia in the latter 1st millennium BC. Phoenicians colonised Portugal during the 7th and 8th centuries BC.
James Marsh was the first to apply this new science to the art of forensics. He was called by the prosecution in a murder trial to give evidence as a chemist in 1832. The defendant, John Bodle, was accused of poisoning his grandfather with arsenic-laced coffee. Marsh performed the standard test by mixing a suspected sample with hydrogen sulfide and hydrochloric acid. While he was able to detect arsenic as yellow arsenic trisulfide, when it was shown to the jury it had deteriorated, allowing the suspect to be acquitted due to reasonable doubt. Annoyed by that, Marsh developed a much better test. He combined a sample containing arsenic with sulfuric acid and arsenic-free zinc, resulting in arsine gas. The gas was ignited, and it decomposed to pure metallic arsenic, which, when passed to a cold surface, would appear as a silvery-black deposit. So sensitive was the test, known formally as the Marsh test, that it could detect as little as one-fiftieth of a milligram of arsenic. He first described this test in The Edinburgh Philosophical Journal in 1836.
While clarifying he was "not a harsh critic of games", Antonov felt "artists and art directors should make their own life a little bit harder by pushing management to take more artistic risks, and use [their] technology [at] a better, higher level".
Sources: en.wikipedia.org
=== Manual === The earliest polarimeters, which date back to the 1830s, required the user to physically rotate one polarizing element (the analyzer) whilst viewing through another static element (the detector). The detector was positioned at the opposite end of a tube containing the optically active sample, and the user used his/her eye to judge the "alignment" when least light was observed. The angle of rotation was then read from a simple fixed to the moving polariser to within a degree or so. Although most manual polarimeters produced today still adopt this basic principle, the many developments applied to the original opto-mechanical design over the years have significantly improved measurement performance. The introduction of a half-wave plate increased "distinction sensitivity", whilst a precision glass scale with vernier drum facilitated the final reading to within ca. ±0.05º. Most modern manual polarimeters also incorporate a long-life yellow LED in place of the more costly sodium arc lamp as a light source.
== Multimodal AI agents == In addition to large language models (LLMs), vision-language models (VLMs) and multimodal foundation models can be used as the basis for agents. Allen Institute for AI released an open-source vision-language model in 2024. Nvidia released a framework for developers to use VLMs, LLMs and retrieval-augmented generation for building AI agents that can analyze images and videos, including video search and video summarization. Microsoft released a multimodal agent model – trained on images, video, software user interface interactions, and robotics data – that the company claimed can manipulate software and robots.
== Applications == Enzyme inhibitors are found in nature and also produced artificially in the laboratory. Naturally occurring enzyme inhibitors regulate many metabolic processes and are essential for life. In addition, naturally produced poisons are often enzyme inhibitors that have evolved for use as toxic agents against predators, prey, and competing organisms. These natural toxins include some of the most poisonous substances known. Artificial inhibitors are often used as drugs, but can also be insecticides such as malathion, herbicides such as glyphosate, or disinfectants such as triclosan. Other artificial enzyme inhibitors block acetylcholinesterase, an enzyme which breaks down acetylcholine, and are used as nerve agents in chemical warfare.
With the dissolution of the Napoleonic Kingdom of Italy in 1814, following the final fall of Emperor Napoleon I after the Battle of Waterloo, Ferdinand's son, Francis IV, assumed the rule as Duke of Modena. In December 1815 he obtained the transfer from his mother Maria Beatrice d'Este of the former imperial fiefs in Lunigiana, not reconstituted by the Congress of Vienna and bestowed upon her. On her death in 1829, he also inherited the Duchy of Massa and Carrara, which she had in turn received from her mother Maria Teresa Cybo-Malaspina, since Salic Law was derogated there by special imperial investiture. In the course of the Italian unification period in the 1830s-60s, the "Austria-Este" dukes were briefly ousted in the revolutions of 1831 and 1848, but soon returned. During the Second Italian War of Independence (April to July 1859) following the Battle of Magenta, the last Duke Francis V was again forced to flee, this time permanently. In December, Modena joined with Tuscany and Parma to form the "United Provinces of Central Italy", which were annexed to the growing Kingdom of Sardinia in March 1860, which led the Italian unification movement, which further led to the proclamation of the Kingdom of Italy in 1861.
Jammu and Kashmir's economy is primarily services-based and agriculture-oriented. The gross domestic product of Jammu and Kashmir was estimated at ₹3.15 lakh crore (US$33 billion) in 2026–27. In the fiscal year 2023–2024, it is expected that Jammu and Kashmir's Gross Domestic Product (GDP) will exceed Rs 2.30 lakh crore, with a growth rate of 10%. Along with horticulture and agriculture, tourism is an important industry for Jammu and Kashmir, accounting for about 7% to its economy. The Kashmir Valley is known for its sericulture and cold-water fisheries. Wood from Kashmir is used to make high-quality cricket bats, popularly known as Kashmir Willow. Major agricultural exports from Jammu and Kashmir include apples, pears, cherries, plums, saffron and walnuts. The traditional Kashmiri handicrafts industry employs a large workforce of around 340 thousand artisans and has potential for producing export goods. Small-scale cottage industries include carpet weaving, silks, shawls, basketry, pottery, copper and silverware, papier-mâché and walnut wood. The horticulture sector is the next biggest source of income in the economy. The temperature of Jammu and Kashmir is also suited to floriculture and can support various species of flora.
Sources: en.wikipedia.org
== Conservation == The conservation of hydrothermal vents has been the subject of sometimes heated discussion in the oceanographic community for the last 20 years. It has been pointed out that it may be that those causing the most damage to these fairly rare habitats are scientists. There have been attempts to forge agreements over the behaviour of scientists investigating vent sites, but, although there is an agreed code of practice, there is no formal international and legally binding agreement. Mineral extraction A key talking point surrounding the conservation of hydrothermal vent ecosystems is deep sea mining. There are four main mineral resources that are under consideration for commercial extraction: manganese nodules, cobalt-rich crusts, Seafloor massive sulfide deposits and phosphorite nodules. Seafloor massive sulfide depositions surrounding hydrothermal vents are a central area of discussion. As discussed above, black smokers produce an abundance of sulfides primarily through the production of Iron Sulfides, namely Pyrite. This sulfide production leads to high sulfide deposition local to many black smokers. Central to the conservation conversation, is weighing the possibilities for sustainable use of newly harvested sulfide against the effects of commercially attaining this sulfide via deep sea mining. The effects of commercially extracting deep sea minerals are largely unknown due to the extremely dynamic nature of a hydrothermal vents ecosystem.
Russell indexes are a family of global stock market indices from FTSE Russell that allow investors to track the performance of distinct market segments worldwide. Many investors use mutual funds or exchange-traded funds based on the FTSE Russell Indexes as a way of gaining exposure to certain portions of the U.S. stock market. Additionally, many investment managers use the Russell Indexes as benchmarks to measure their own performance. Russell's index design has led to more assets benchmarked to its U.S. index family than all other U.S. equity indexes combined. The best-known index of the series is the Russell 2000, which tracks US small-cap stocks and is made up of the bottom 2,000 stocks in the Russell 3000 index.
==== Antibodies ==== Two monoclonal antibodies have been approved to target amyloid beta – donanemab and lecanemab – but as of 2025, their role in treatment is uncertain because of side effects, questions about efficacy, and cost. Lecanemab is approved in the US, including a boxed warning about amyloid-related imaging abnormalities. A 2026 meta-analysis found that anti-amyloid antibodies have no effect in the treatment of Alzheimer's disease. A 2026 Cochrane review found no effect or at best small effect. Anti-amyloid antibodies may cause harmful adverse effects and have been shown to slow disease progression only in individuals with "early and mild AD, and cognitive benefits were often marginal."
Urinalysis — assessment of the visual properties of the urine, chemical evaluation using urine test strips, and microscopic examination Urine creatinine, creatinine clearance — used to assess kidney function Albumin/creatinine ratio — used to diagnose microalbuminuria Urine osmolality — measure of the solute concentration of urine Urine specific gravity ― another measure of urine concentration Urine electrolyte levels — measurement of electrolytes such as sodium and potassium in urine Urine anion gap — used to distinguish between some causes of metabolic acidosis
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
It is a set of checks performed before or during an HPLC run to confirm the system works as expected. Parameters may include resolution, tailing factor, theoretical plates, and retention time precision. Failure can trigger maintenance, method adjustment, or repeat analysis.
Validation follows a planned protocol that tests accuracy, precision, specificity, linearity, range, detection limits, quantitation limits, and robustness. Results are compared against predefined acceptance criteria. The validation report supports regulatory filing or routine use.
Revalidation may be needed after changes to column chemistry, mobile phase, detection, sample preparation, or instrument type. It can also follow a pattern of out-of-specification results. The scope depends on whether the change affects method performance.
It measures the presence and amount of one or more compounds in a liquid sample. Separation occurs in a column, and detection produces a signal proportional to concentration. Identification usually requires comparison with a known reference standard under the same conditions.